Melanocortin receptor comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-01-13. Numbers and descriptions here follow the published literature rather than marketing material.
Development is attributed to researchers at the Institute of Molecular Genetics in Moscow during the early 1980s, building on earlier Soviet work with ACTH fragments. Russian regulatory approval followed for intranasal use, and the compound has remained commercially available there for decades. Most published human data originate from Russian and, later, some Eastern European clinical reports, which are not always accessible in English translation. Outside that region the material is generally handled as a research chemical rather than a licensed medicine.
Regulatory status differs sharply between jurisdictions. In Russia the peptide is registered as a prescription nasal preparation, while agencies such as the United States Food and Drug Administration have not approved it for any indication. Products sold elsewhere are typically labeled for laboratory research only, and such labels shift responsibility for safe handling to the purchaser. Because the same name covers pharmaceutical-grade nasal drops and bulk research powder, identity and purity documentation becomes the main practical concern when comparing sources.
Semax is a synthetic seven-amino-acid peptide whose sequence extends the ACTH(4-10) fragment with a C-terminal proline-glycine-proline tripeptide. The commonly cited sequence is Met-Glu-His-Phe-Pro-Gly-Pro, giving a molecular formula near C37H51N9O10S and a molecular weight close to 813.9 g/mol. It belongs to the broader class of synthetic ACTH fragments studied for central nervous system effects rather than for adrenal steroid stimulation. In practice the material appears as a lyophilized white powder for laboratory work or as a dilute saline solution in clinical settings.
Scientific literature on semax is unevenly distributed. A substantial share of published work originates from a small number of laboratories in Russia, while independent replication elsewhere is limited. Human data consist mostly of small trials with short follow-up, and several reported outcomes rely on subjective rating scales. Questions about how much intact peptide reaches the central nervous system after nasal administration, and how long it persists there, are still unresolved. The compound is best described as an active research subject rather than a settled pharmacological agent.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It was derived from the ACTH(4-10) fragment, a short segment of adrenocorticotropic hormone that lacks the hormonal activity associated with the full-length peptide. Researchers at the Institute of Molecular Genetics in Moscow developed the compound during the 1980s. It has been registered as a pharmaceutical product in Russia and several neighbouring countries, where it is supplied as a nasal solution, and it is also sold internationally as a research chemical.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide (ACTH fragment analog) | Not a steroid; does not belong to the melanocortin agonist drugs by marketing category |
| Molecular formula | C37H51N9O10S (commonly cited) | Reported values vary slightly with salt and counter-ion content |
| Appearance | White to off-white lyophilized powder | A single batch may appear as a loose cake or fluffy solid |
| Solubility | Freely soluble in water and aqueous buffer | Stock solutions are usually prepared in sterile water or saline |
| Typical storage | −20 °C or below, desiccated and protected from light | Seal opened vials promptly to limit moisture uptake |
The parent fragment ACTH(4-10) carries the sequence Met-Glu-His-Phe-Arg-Trp-Gly. Semax replaces the arginine and tryptophan positions with a proline-glycine-proline tail, giving Met-Glu-His-Phe-Pro-Gly-Pro. That change removes residues associated with adrenal stimulation, so the peptide does not drive cortisol release the way full ACTH does. This distinction shapes how the compound is grouped in the literature, where it sits with neuropeptides and peptide neuromodulators rather than with corticosteroids.
Regulatory status varies sharply by country. Semax is registered for medical use in Russia, where it appears in formularies as a nasal solution, and it also holds registration in a small number of neighbouring states. It has no approval from the United States Food and Drug Administration or the European Medicines Agency, and it is not a scheduled controlled substance in most jurisdictions. Elsewhere it circulates mainly as laboratory material, so purity documentation comes from suppliers rather than from a national pharmacopoeia.
Semax is a synthetic heptapeptide whose sequence is Met-Glu-His-Phe-Pro-Gly-Pro. It was developed as a fragment analog of adrenocorticotropic hormone, modeled specifically on the ACTH(4-10) region. The first four residues reproduce that fragment, while a Pro-Gly-Pro tripeptide is appended at the C-terminus. Work on the compound originated in Russia, where it entered clinical use as an intranasal preparation. Its sequence places it among short regulatory peptides studied for effects on the central nervous system rather than on the adrenal axis.
The C-terminal Pro-Gly-Pro extension is not incidental. Proline-rich tails are known to resist several common peptidases, and the published literature attributes the longer half-life of Semax, relative to unmodified ACTH fragments, to this feature. The modification also removes the melanocyte-stimulating and corticosteroidogenic activity that characterizes longer ACTH-derived sequences. Because the molecule is small and hydrophilic, it is typically formulated as an aqueous solution for intranasal or parenteral delivery. Acetylation or amidation at the termini appears in closely related research peptides and shifts the mass by a fixed increment.
== Mechanism == The proposed mechanism of retinal dehydrogenase begins with a key cysteine residue in the active site attacking the aldehyde group in retinal to form a thiohemiacetal intermediate. Then, a hydride shift is facilitated by the enzyme to form NADH and a thioester intermediate. This hydride shift has been shown to be stereospecific in a subset (class 3) of retinal dehydrogenases. The thioester intermediate is then attacked by a water molecule, which is made more nucleophilic by a glutamate residue that lies near the active site. There has been some debate as to whether the glutamate residue near the active site acts as a general base during the reaction or whether it is more limited and merely deprotonates the catalytic cysteine to make the cysteine more nucleophilic. Kinetic studies have supported this mechanism by showing that the reaction follows an ordered sequential path with NAD+ binding first which is followed by the binding of retinal, the catalytic breakdown of retinal to retinoic acid, the release of retinoic acid, and finally the release of NADH.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
An important physical property characterizing the flow of liquids is viscosity. Intuitively, viscosity describes the resistance of a liquid to flow. More technically, viscosity measures the resistance of a liquid to deformation at a given rate, such as when it is being sheared at finite velocity. A specific example is a liquid flowing through a pipe: in this case the liquid undergoes shear deformation since it flows more slowly near the walls of the pipe than near the center. As a result, it exhibits viscous resistance to flow. In order to maintain flow, an external force must be applied, such as a pressure difference between the ends of the pipe. The viscosity of liquids decreases with increasing temperature. Precise control of viscosity is important in many applications, particularly the lubrication industry. One way to achieve such control is by blending two or more liquids of differing viscosities in precise ratios. In addition, various additives exist which can modulate the temperature-dependence of the viscosity of lubricating oils. This capability is important since machinery often operate over a range of temperatures (see also viscosity index). The viscous behavior of a liquid can be either Newtonian or non-Newtonian. A Newtonian liquid exhibits a linear strain/stress curve, meaning its viscosity is independent of time, shear rate, or shear-rate history. Examples of Newtonian liquids include water, glycerin, motor oil, honey, or mercury.
=== Discussions with other members of Maduro's government === According to anonymous sources, Reuters reported that United States officials established conversations with Venezuelan minister of interior Diosdado Cabello months before, in order to avoid using the security services or militant ruling-party supporters to target the Venezuelan opposition in case of an attack. According to the Miami Herald, a circle of Venezuelan officials centered on Delcy Rodríguez and her brother, Jorge, privately outlined a roadmap for post-Maduro Venezuela, in which Delcy would act as figurehead and exiled general Miguel Rodríguez Torres (no relationship to the Rodriguez siblings) would lead a "transitional government", dubbed "Madurismo without Maduro"; in return, Venezuela would welcome US investors and gradually loosen ties to US rivals such as Iran and Russia. The Venezuelan proposals were made to US envoy Richard Grenell through Qatari channels; the Trump administration reportedly rejected the overtures. According to the Financial Times, Delcy Rodríguez's brother Jorge Rodríguez had held talks with the United States government in 2025 to have his sister lead a post-Maduro transitional government, though those talks had included Maduro being allowed to go into exile instead of being captured. Anonymous sources speaking for The Guardian said that Delcy and Jorge Rodríguez were communicating with the American and Qatar officials. According to American officials she told them in December that "'Maduro needs to go" and stating "I'll work with whatever is the aftermath.'"
=== Biodegradation === Some organisms are capable of metabolizing alkanes. The methane monooxygenases convert methane to methanol. For higher alkanes, cytochrome P450 convert alkanes to alcohols, which are then susceptible to degradation.
Sources: en.wikipedia.org
differs when considering the effects of vaccinations and when the real-time dependence of fatality and recovery rates diverge. These differences have been highlighted for stationary ratios and gradually decreasing fatality rates. The case of stationary ratios allows one to construct a diagnostics method to extract analytically all SIRVD model parameters from measured COVID-19 data of a completed pandemic wave.
The New Zealand government joins the British, Australian, Canadian and Norwegian governments in imposing travel bans on Israeli National Security Minister Itamar Ben-Gvir and Finance Minister Bezalel Smotrich for allegedly inciting "extremist violence" against Palestinians in the West Bank. The National Library of New Zealand confirms it will destroy 500,000 unwanted books after US publishers challenged its plans to sell the collection to the online archive Internet Archive. The Aratere experiences an electrical fault at 8:50pm, delaying a night-time voyage from Picton to Wellington. 13 June: Tingjun Cao is sentenced to life imprisonment with a minimum term of 17 years for the murder of Christchurch real estate agent Yanfei Bao. A fire in Lyttelton destroys two properties, damages a third and leads to the evacuation of local residents. Police seize 478 firearms in Gore, marking one of the largest firearms seizures in New Zealand history. 15 June – Auckland department store Smith & Caughey's closes its Queen Street store, ending 145 years of trading. 17 June: A ban of the distribution, manufacture, sale and supply of disposable vapes, and new restrictions on advertising and promotion of vaping products, come into effect. New World's Victoria Park supermarket in Auckland experiences significant damage during a massive fire. The Sentencing (Reinstating Three Strikes) Amendment Act 2024 comes into force, applying to 42 serious crimes including homicides, sexual assault, aggravated robbery, abduction, strangulation and suffocation.
== Other uses == French Defence (Encyclopaedia of Chess Openings code) Combat 18, a British neo-Nazi organisation 18th century (1701–1800 AD) Android 18, character from Dragon Ball Franchise Bill C-18, Canada's Online News Act
== Clinical significance == Glycomacropeptide (GMP), generated by cleavage of κ-casein, has been reported to increase digestive efficiency, prevent neonate hypersensitivity to ingested proteins, and inhibit gastric pathogens.
Sources: en.wikipedia.org
It is a short synthetic peptide built from seven amino acids: methionine, glutamic acid, histidine, phenylalanine and three prolines. The sequence derives from the 4-10 fragment of adrenocorticotropic hormone with an added proline-glycine-proline tail. No plant or animal extract is involved; the material is produced by solid-phase peptide synthesis.
It was developed in the Soviet Union during the early 1980s by groups at the Institute of Molecular Genetics in Moscow. Russian approval for intranasal use followed, and it has been marketed there since. Western laboratories encountered it mainly through translated literature and, later, through online research-chemical trade.
It holds a Russian registration as a prescription nasal product but has no approval from the European Medicines Agency or the United States Food and Drug Administration. Buyers outside Russia usually receive material sold strictly for laboratory research. That distinction matters because research-grade and pharmaceutical-grade products carry different documentation and testing expectations.
Semax is based on the ACTH(4-10) fragment, a seven-amino-acid segment of adrenocorticotropic hormone. The synthetic peptide retains the core sequence while removing regions associated with endocrine activity. This modification is intended to isolate effects on the nervous system.